Anytime Fitness Novato

This weeks BURN group, was on we had Yasmine join in as well shortly after. Five in group today! Great job Novato! Special thank you to Signe, Patrick, Kenny, Yasmine, and Kelsey! We love you guys! #afnovato #traininwithraymond #novato #aftraining #afteamsessions #anytimefitness #fitness #workout #gym #bodybuilding #fitfam #fitnessmotivation #health #virtualtrainer #training #letsmakehealthyhappen #motivation #yoga #healthy #gymlife #exercise #personaltrainer #personaltraining #muscle #functionaltraining #certifiedpersonaltrainer #cardio #strongaf #healthylifestyle

#AFfamily, listen up! We’re breaking down everything you need to know about monitoring your heart rate during a workout to help you make healthy happen. Don’t miss it!

Eating healthy eating healthy feels great!!!!! #afnovato #traininwithraymond #novato #aftraining #afteamsessions #anytimefitness #fitness #workout #gym #bodybuilding #fitfam #fitnessmotivation #health #virtualtrainer #training #letsmakehealthyhappen #motivation #yoga #healthy #gymlife #exercise #personaltrainer #personaltraining #muscle #functionaltraining #certifiedpersonaltrainer #cardio #strongaf #healthylifestyle

A strong back = a better life. Seriously! Having a strong back can: Improve posture Eliminate back pain Make day-to-day tasks easier... And lucky for you, we’re sharing 7 of our favorite back exercises over on Coach. Care. Connect. Check them out!

If you’ve ever stepped on the scale and seen a higher number than you expected, despite all of your efforts to make healthy happen, don’t panic! There's a perfectly good explanation and it’s over on Coach. Care. Connect.

On this lovely Sunday, remember to take a deep breath and relax. Enjoy your family, your friends, and indulge yourself in a nice cup of coffee! Happy Sunday!

Hello January 2nd! New first chapter of the twelve months and you should start it with positive resolutions, inspiration and great energy! GO AF FAM!!

Monday are for fresh starts to do the impossible! The body achieves what the mind believes. Keep going and don't stop! We believe in you! Kickstart your Monday and make this the best week of your life!

Happy New Year #AFfamily! Are you new to the gym? First off, welcome! We're so happy you're here. If you're looking for a good place to start in your fitness journey, this article can help you as you find your way: https://bit.ly/3mGChmJ.

We are wishing you 12 months of success, 52 weeks of laughter, 365 days of fun, 8760 hours of joy, 525600 minutes of good luck, and 31536000 seconds of happiness. Happy New Year! YAY!!! 2021 will be amazing!! We just know it!!!

Let's start this Monday off right with a full-body workout that will kickstart your week in the right direction. Head to Coach. Care. Connect. and make healthy happen!

Happy Friday AF FAM!! Woohoo! Time to relax because you deserve it! All the hard work is paying off! Can we just say how much we are so proud of each and everyone of you for coming in to work on yourself. You are making a huge difference not to us but yourself, and we love it! Keep it up! Keep going! We are always here to help you rise to the top, help you reach your goals, help you grow everyday, and help you get stronger inside and out! You deserve a round of applause! YAYYY! :D

Member / training client, Jose Garcia repping his Anytime Fitness shirt!! Make sure you guys stop by the office and get yourself a shirt for only $14.99!! #afnovato #novato #letsmakehealthyhappen #repping #trainingwithcarlos #healthiswealth

We’re bringing you these delicious Dark Chocolate Cherry Bites right in time for the holidays! In less than five minutes, you’ll have a festive, guilt-free treat that your whole family will love: https://bit.ly/33g8haH.

Hi AF family! I’ve got a question for you: If I could snap my fingers, and either make you incredibly strong, or drop that stubborn 10 pounds of unwanted weight, which would you choose first? Whichever path you choose, our staff of certified personal trainers, here at Anytime Fitness, in #novatocalifornia, are ready to serve you. Book your fitness consultation, or what I like to refer to as your Hour of Power, today by calling 415-898-1161 or email [email protected] put in subject line FC let’s make healthy happen together Novato! Whether you’re a Person on the Go with an incredibly demanding schedule, trying to Lose Unwanted weight, Recovering from Injuries, working on Building Size, Stamina, and Strength, or just trying to make health, and fitness, a Lifestyle, we’re here to help! What makes our programs so much more effective than traditional training programs out there is, that we use Undulated Periodization, or DUP Training. In other words, the workouts, are always a surprise! We keep our client’s body guessing, with something fresh, and new, every time we meet. We’ll train everything from your entire body, through your workout, all the way to the stabilizing muscles of your core. We make you stronger from the inside-out! You may be asking yourself, When am I going to make time for fitness, with my schedule? or How do I get set up on the right path, to reach my health and fitness goals? Trust us, we know it can be a challenge to balance your busy schedule, and to make time for yourself. Thankfully, we have enough staff, to walk you through the process of designing a schedule, that makes sense for your life-style. The best way to get on the right path, is to set a Fitness Consultation, with our Fitness Manager, Ray, or any of the certified personal trainers, on staff. In your Hour of Power, I will go over your story, your goals, and put you through my High-5 Warm-Up, which will help to evaluate a great starting point for you, to reach your goals. #afnovato #traininwithraymond #novato #aftraining #afteamsessions #anytimefitness #fitness #workout #gym #bodybuilding #fitfam #fitnessmotivation #health #virtualtrainer #training #letsmakehealthyhappen #motivation #yoga #healthy #gymlife #exercise #personaltrainer #personaltraining #muscle #functionaltraining #certifiedpersonaltrainer #cardio #strongaf #healthylifestyle See more

Sleep and exercise are both equally important to making healthy happen, but if you can only pick one, which one should you choose: or ? The answer is over on Coach. Care. Connect. Don’t miss it!

Meet your Anytime Fitness Club and Assistant managers! Ana Benitez and Stephanie Sanchez. We are always here to help you answer your questions about memberships, support your journey, and to helping you to reach your goals in life. We are grateful to be apart of the AF FAM. Don't be shy! Stop by and say hello! #anytimefitnessnovato #letushelpyou #letushelpyourise #letyouhelpgrow #letsmakehealthyhappen #memberships #fitnessmotivation #fitnessjourney #tnessgoals #webelieveinyou #wegotyou #healthylifestyle #anytimefitnessletsmakehealthyhappen #movtivation

Happy Friday AF FAM! Wishing you all a great Friday and a wonderful weekend. We truly miss seeing you all inside the gym working out. BUT! Don't worry, we will reunite soon! As for the meantime... TREAT YO SELF and enjoy the weekend with some nice hot chocolate. Yum Yum! :)

Small changes can make a BIG impact on your daily life and today, we're focusing on 5 simple ways you can improve your wellbeing and day-to-day life without overhauling your habits. Head over to Coach. Care. Connect and check it out: https://bit.ly/2TcpFaT.

MEMBERS APPRECIATION DAY!! Thank you all for the love and support you have given us! We want to thank you for making us your second home and to help you reach to your goals! Please stop by and grab your goodies! We cannot wait to see you! GO AF FAM!

When you're on the go, a protein bar can be a great option for fueling up without derailing your fitness goals. However, some protein bars are a lot more like candy bars so we're sharing a few tips that will help you make the most out of your protein bar snacking and avoid running on E.

The vote is precious. It is the most powerful non-violent tool we have in a democratic society, and we must use it. ~John Lewis, or as Abraham Lincoln once said: Elections belong to the people. It's their decision. If they decide to turn their back on the fire and burn their behinds, then they will just have to sit on their blisters. Have a safe, and wonderful evening out there everyone. Your vote, makes all the difference. #afnovato #traininwithraymond #novato #aftraining #afteamsessions #anytimefitness #virtualtrainer #workout #gym #bodybuilding #fitfam #fitnessmotivation #health #fit #fit #training #letsmakehealthyhappen #motivation #healthy #yoga #gymlife exercise #personaltrainer #personaltraining #certifiedpersonaltrainer #cardio #strongaf #healthylifestyle

No gloves required for the full-body, boxing-inspired workout. Boxers train for endurance, strength and coordination and this workout hits on all three! This workout is mainly focused on body weight training, so whether you're in your living room, the park or the gymyou'll be able to train like a pro.

As a token of our gratitude, we want to celebrate your amazing supports and commitment coming to Anytime Fitness. Please save the date and stop by and grab your honor bar goodies. We will start at 10am sharp on that date 11/04/2020. Our fitness manager Ray along with all of our wonderful trainers wants to give you all a treat, and book your free fitness consultation! Stop by and treat yourself! THANK YOU TO YOU ALL!

Happy November AF Fam! Hey listen, November, is when the holiday's really kick off! Everyone becomes super busy planning for family gathering's and preparing for the year's end. To make the end of the year, the best of the year, we are having fantastic specials on personal training here in Novato! With a busy schedule, it can become overwhelming to make time for yourself and get a quality workout in. We understand, and that is why we are offering you a free personal training ...fitness consultation to help get you started. Give yourself the gift of fitness, and freedom to choose, the plan that works best for your schedule. I'm standing by waiting to take your calls, and messages. Book an "Hour of Power", for yourself, so that you can show up as the best version of you, for the holiday's. Let's make healthy happen together Novato! #afnovato #traininwithraymond #novato #aftraining #afteamsessions #anytimefitness #virtualtrainer #workout #gym #bodybuilding #fitfam #fitnessmotivation #health #fit #fit #training #letsmakehealthyhappen #motivation #healthy #yoga #gymlife exercise #personaltrainer #personaltraining #certifiedpersonaltrainer #cardio #strongaf #healthylifestyle See more